euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


Entry text : AF009606


[Entry details]
ID   AF009606; SV 1; linear; genomic RNA; STD; VRL; 9646 BP.
XX
AC   AF009606; 
XX
DT   23-AUG-1997 (Rel. 52, Created)
DT   23-JAN-2011 (Rel. 122, Last updated, Version 0)
XX
DE   Hepatitis C virus complete genome, complete 5'UTR, complete CDS (Contains:
DE   C, E1, E2, P7, NS2, NS3, NS4A, NS4B, NS5A, NS5B), complete 3'UTR.
XX
KW   complete genome; complete 5'UTR; complete CDS; C; E1; E2; P7; NS2; NS3;
KW   NS4A; NS4B; NS5A; NS5B; complete 3'UTR.
XX
OS   Hepatitis C virus subtype 1a
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae;
OC   Hepacivirus.
XX
RN   [1]
RP   1-9646
RX   DOI; 10.1126/science.277.5325.570.
RX   PUBMED; 9228008.
RA   Kolykhalov A.A., Agapov E.V., Blight K.J., Mihalik K., Feinstone S.M., Rice
RA   C.M.;
RT   "Transmission of hepatitis C by intrahepatic inoculation with transcribed
RT   RNA";
RL   Science 277(5325):570-574(1997).
XX
RN   [2]
RP   1-9646
RA   Kolykhalov A.A., Rice C.M.;
RT   ;
RL   Submitted (19-JUN-1997) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Microbiology, Washington University School of Medicine, 660 South
RL   Euclid Ave., St. Louis, MO 63110-1093, USA
XX
DR   GOA; P0C045.
DR   InterPro; IPR002522; HCV_core_N.
DR   UniProtKB/Swiss-Prot; P0C045; F_HCVH.
XX
CC   This entry is part of the european Hepatitis C Virus database (euHCVdb,
CC   http://euhcvdb.ibcp.fr). The euHCVdb is funded as part of european
CC   contracts HepCVax (EC # QLK2-CT-2002-01329, http://hepcvax.ibcp.fr) and
CC   VIRGIL (EC # CT-2004-503359, http://www.virgil-net.org).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9646
FT                   /db_xref="taxon:31646"
FT                   /db_xref="EMBL:AF009606"
FT                   /db_xref="euHCVdb:AF009606"
FT                   /genotype="1a"
FT                   /genotype_conf="1a"
FT                   /genotype_prov="1a"
FT                   /isolate="H77"
FT                   /mol_type="genomic RNA"
FT                   /note="assembled from cDNA library representing a
FT                   population of Hepatitis C virus genomes; viable virus can
FT                   be reconstituted from this sequence"
FT                   /organism="Hepatitis C virus subtype 1a"
FT   5'UTR           1..341
FT                   /function="5'UTR highly conserved genomic region (contains
FT                   four structural domains (I to IV), domains II to IV make up
FT                   the internal ribosome entry site (IRES))"
FT                   /standard_name="5UTR"
FT   RBS             44..354
FT                   /function="The internal ribosome entry site (IRES) is made
FT                   up by domains II to IV of the 5'UTR"
FT                   /standard_name="IRES"
FT   stem_loop       5..20
FT                   /function="5'UTR domain I has a regulatory effect for the
FT                   replication and translation of the genome"
FT                   /standard_name="5UTR-dI"
FT   stem_loop       44..118
FT                   /function="5'UTR domain II is a component of the IRES"
FT                   /standard_name="5UTR-dII"
FT   stem_loop       125..323
FT                   /function="5'UTR domain III is a component of the IRES"
FT                   /standard_name="5UTR-dIII"
FT   stem_loop       331..354
FT                   /function="5'UTR domain IV is a component of the IRES"
FT                   /standard_name="5UTR-dIV"
FT   misc_feature    869..1292
FT                   /note="C/E1 genotyping region"
FT   misc_feature    8276..8615
FT                   /note="NS5B genotyping region"
FT   gene            342..9377
FT                   /locus_tag="HCVORF1"
FT   CDS             342..9377
FT                   /codon_start=1
FT                   /db_xref="UniProtKB/Swiss-Prot:P27958"
FT                   /locus_tag="HCVORF1"
FT                   /product="Complete HCV polyprotein (contains C, E1, E2, P7,
FT                   NS2, NS3, NS4A, NS4B, NS5A, NS5B)."
FT                   /translation="MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLG
FT                   VRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSR
FT                   PSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVN
FT                   YATGNLPGCSFSIFLLALLSCLTVPASAYQVRNSSGLYHVTNDCPNSSIVYEAADAILH
FT                   TPGCVPCVREGNASRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLC
FT                   GSVFLVGQLFTFSPRRHWTTQDCNCSIYPGHITGHRMAWDMMMNWSPTAALVVAQLLRI
FT                   PQAIMDMIAGAHWGVLAGIAYFSMVGNWAKVLVVLLLFAGVDAETHVTGGSAGRTTAGL
FT                   VGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLAS
FT                   CRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVG
FT                   TTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGN
FT                   NTLLCPTDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGG
FT                   VEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQ
FT                   NIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQAEAALENLVI
FT                   LNAASLAGTHGLVSFLVFFCFAWYLKGRWVPGAVYAFYGMWPLLLLLLALPQRAYALDT
FT                   EVAASCGGVVLVGLMALTLSPYYKRYISWCMWWLQYFLTRVEAQLHVWVPPLNVRGGRD
FT                   AVILLMCVVHPTLVFDITKLLLAIFGPLWILQASLLKVPYFVRVQGLLRICALARKIAG
FT                   GHYVQMAIIKLGALTGTYVYNHLTPLRDWAHNGLRDLAVAVEPVVFSRMETKLITWGAD
FT                   TAACGDIINGLPVSARRGQEILLGPADGMVSKGWRLLAPITAYAQQTRGLLGCIITSLT
FT                   GRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQD
FT                   LVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSG
FT                   GPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQV
FT                   AHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRT
FT                   ITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARL
FT                   VVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDE
FT                   LAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQT
FT                   VDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCEC
FT                   YDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQS
FT                   GENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLT
FT                   HPITKYIMTCMSADLEVVTSTWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPD
FT                   REVLYQEFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVITPAVQTNWQK
FT                   LEVFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTGQTLLFNILGGW
FT                   VAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLVDILAGYGAGVAGALVAFKIMSGEVP
FT                   STEDLVNLLPAILSPGALVVGVVCAAILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTH
FT                   YVPESDAAARVTAILSSLTVTQLLRRLHQWISSECTTPCSGSWLRDIWDWICEVLSDFK
FT                   TWLKAKLMPQLPGIPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRT
FT                   CRNMWSGTFPINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNL
FT                   KCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHEYPVGSQLPCEPEPDVA
FT                   VLTSMLTDPSHITAEAAGRRLARGSPPSMASSSASQLSAPSLKATCTANHDSPDAELIE
FT                   ANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREVSVPAEILRKSRRFARALPV
FT                   WARPDYNPPLVETWKKPDYEPPVVHGCPLPPPRSPPVPPPRKKRTVVLTESTLSTALAE
FT                   LATKSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDVESYSSMPPLEGEPGDPDLSDGSW
FT                   STVSSGADTEDVVCCSMSYSWTGALVTPCAAEEQKLPINALSNSLLRHHNLVYSTTSRS
FT                   ACQRQKKVTFDRLQVLDSHYQDVLKEVKAAASKVKANLLSVEEACSLTPPHSAKSKFGY
FT                   GAKDVRCHARKAVAHINSVWKDLLEDSVTPIDTTIMAKNEVFCVQPEKGGRKPARLIVF
FT                   PDLGVRVCEKMALYDVVSKLPLAVMGSSYGFQYSPGQRVEFLVQAWKSKKTPMGFSYDT
FT                   RCFDSTVTESDIRTEEAIYQCCDLDPQARVAIKSLTERLYVGGPLTNSRGENCGYRRCR
FT                   ASGVLTTSCGNTLTCYIKARAACRAAGLQDCTMLVCGDDLVVICESAGVQEDAASLRAF
FT                   TEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWE
FT                   TARHTPVNSWLGNIIMFAPTLWARMILMTHFFSVLIARDQLEQALNCEIYGACYSIEPL
FT                   DLPPIIQRLHGLSAFSLHSYSPGEINRVAACLRKLGVPPLRAWRHRARSVRARLLSRGG
FT                   RAAICGKYLFNWAVRTKLKLTPIAAAGRLDLSGWFTAGYSGGDIYHSVSHARPRWFWFC
FT                   LLLLAAGVGIYLLPNR"
FT   mat_peptide     342..914
FT                   /function="C protein coding sequence (c sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="RNA binding nucleocapsid protein (p21) (capsid)
FT                   (core  protein) (nucleocapsid) (C protein). Produced by
FT                   proteolytic processing by the host signal peptidases"
FT                   /prod_ft=(pos:1..191, chain, "C protein")
FT                   /prod_ft=(pos:1..1, init_met, "Removed from C protein by
FT                   the cellular aminopeptidase")
FT                   /standard_name="C"
FT   mat_peptide     915..1490
FT                   /function="E1 protein coding sequence (e1 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="Envelope glycoprotein 1 (gp31) (E1 protein).
FT                   Produced by proteolytic processing by the host signal
FT                   peptidases. E1 forms heterodimers with the viral E2
FT                   envelope glycoprotein"
FT                   /prod_ft=(pos:192..383, chain, "E1 protein")
FT                   /prod_ft=(pos:353..381, transmem, "Potential transmembrane
FT                   region of E1")
FT                   /standard_name="E1"
FT   mat_peptide     1491..2579
FT                   /function="E2 protein coding sequence (e2 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="Envelope glycoprotein 2 (GP70) (E2 protein).
FT                   Produced by proteolytic processing by the host signal
FT                   peptidases. E2 forms heterodimers with the viral E1
FT                   envelope glycoprotein"
FT                   /prod_ft=(pos:384..746, chain, "E2 protein")
FT                   /prod_ft=(pos:384..410, site, "Hypervariable region 1
FT                   (HVR1)")
FT                   /prod_ft=(pos:473..480, site, "Hypervariable region 2
FT                   (HVR2)")
FT                   /prod_ft=(pos:659..670, domain, "PKR/eIF2aplha
FT                   phosporylation homology domain (PePHD)")
FT                   /prod_ft=(pos:718..741, transmem, "Potential transmembrane
FT                   region of E2")
FT                   /standard_name="E2"
FT   mat_peptide     2580..2768
FT                   /function="P7 protein coding sequence (p7 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="P7 protein. Produced by proteolytic processing by
FT                   the host signal peptidases"
FT                   /prod_ft=(pos:747..809, chain, "P7 protein")
FT                   /standard_name="P7"
FT   mat_peptide     2769..3419
FT                   /function="NS2 protein coding sequence (ns2 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS2 protein. Produced by autoproteolytic
FT                   processing"
FT                   /prod_ft=(pos:810..1026, chain, "Cysteine protease (NS2
FT                   protein) (P23)")
FT                   /prod_ft=(pos:903..1026, model3d, "NS2-3 autoprotease
FT                   catalytic domain domain (domain I) homology molecular model
FT                   using template PDB:2hd0")
FT                   /standard_name="NS2"
FT   mat_peptide     3420..5312
FT                   /function="NS3 protein coding sequence (ns3 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS3 protein. Produced by autoproteolytic
FT                   processing"
FT                   /prod_ft=(pos:1027..1657, chain, "NS3 protein (P70)
FT                   [Includes: N-ter serine protease; C-ter NTPase and RNA
FT                   helicase]")
FT                   /prod_ft=(pos:1027..1206, domain, "NS3 protease domain")
FT                   /prod_ft=(pos:1213..1657, domain, "NS3 helicase domain")
FT                   /prod_ft=(pos:1029..1657, model3d, "NS3 protein homology
FT                   molecular model using template PDB:1cu1A")
FT                   /standard_name="NS3"
FT   mat_peptide     5313..5474
FT                   /function="NS4A protein coding sequence (ns4a sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS4A protein. Produced by proteolytic processing
FT                   by the HCV NS3 protease"
FT                   /prod_ft=(pos:1658..1711, chain, "NS4A protein (P8)")
FT                   /prod_ft=(pos:1678..1689, domain, "NS3 protease cofactor")
FT                   /prod_ft=(pos:1678..1689, model3d, "NS4A homology molecular
FT                   model using template PDB:1cu1Z")
FT                   /standard_name="NS4A"
FT   mat_peptide     5475..6257
FT                   /function="NS4B protein coding sequence (ns4b sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS4B protein. Produced by proteolytic processing
FT                   by the HCV NS3 protease"
FT                   /prod_ft=(pos:1712..1972, chain, "NS4B protein (P27)")
FT                   /standard_name="NS4B"
FT   mat_peptide     6258..7601
FT                   /function="NS5A protein coding sequence (ns5a sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS5A protein. Produced by proteolytic processing
FT                   by the HCV NS3 protease. NS5A seems to have a
FT                   transcriptional activatory role"
FT                   /prod_ft=(pos:1973..2420, chain, "Serine phosphoprotein
FT                   (NS5A protein) (P58)")
FT                   /prod_ft=(pos:2209..2248, site, "Interferon sensitivity
FT                   determining region (ISDR)")
FT                   /prod_ft=(pos:2209..2274, domain, "PKR binding domain")
FT                   /prod_ft=(pos:2326..2334, site, "Nuclear localisation
FT                   signal (NLS)")
FT                   /prod_ft=(pos:2356..2379, site, "Variable region V3")
FT                   /prod_ft=(pos:2008..2170, model3d, "NS5A zinc-binding
FT                   domain (domain I) homology molecular model using template
FT                   PDB:1zh1")
FT                   /standard_name="NS5A"
FT   mat_peptide     7602..9374
FT                   /function="NS5B protein coding sequence (ns5b sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS5B protein. Produced by proteolytic processing
FT                   by the HCV NS3 protease. NS5B is a RNA-dependent RNA
FT                   polymerase that plays an essential role in virus
FT                   replication"
FT                   /prod_ft=(pos:2421..3011, chain, "RNA-dependent RNA
FT                   polymerase (NS5B protein) (P68)")
FT                   /prod_ft=(pos:2423..2986, model3d, "NS5B RNA-dependent RNA
FT                   polymerase homology molecular model using template PDB:
FT                   1c2pB")
FT                   /standard_name="NS5B"
FT   3'UTR           9378..9646
FT                   /function="3'UTR (contains a polypyrimidine stretch and the
FT                   conserved X region)"
FT                   /standard_name="3UTR"
FT   stem_loop       9549..9646
FT                   /function="3'UTR conserved X region"
FT                   /standard_name="3UTR-rX"
XX
SQ   Sequence 9646 BP; 1889 A; 2893 C; 2724 G; 2140 T; 0 other;
     gccagccccc tgatgggggc gacactccac catgaatcac tcccctgtga ggaactactg        60
     tcttcacgca gaaagcgtct agccatggcg ttagtatgag tgtcgtgcag cctccaggac       120
     cccccctccc gggagagcca tagtggtctg cggaaccggt gagtacaccg gaattgccag       180
     gacgaccggg tcctttcttg gataaacccg ctcaatgcct ggagatttgg gcgtgccccc       240
     gcaagactgc tagccgagta gtgttgggtc gcgaaaggcc ttgtggtact gcctgatagg       300
     gtgcttgcga gtgccccggg aggtctcgta gaccgtgcac catgagcacg aatcctaaac       360
     ctcaaagaaa aaccaaacgt aacaccaacc gtcgcccaca ggacgtcaag ttcccgggtg       420
     gcggtcagat cgttggtgga gtttacttgt tgccgcgcag gggccctaga ttgggtgtgc       480
     gcgcgacgag gaagacttcc gagcggtcgc aacctcgagg tagacgtcag cctatcccca       540
     aggcacgtcg gcccgagggc aggacctggg ctcagcccgg gtacccttgg cccctctatg       600
     gcaatgaggg ttgcgggtgg gcgggatggc tcctgtctcc ccgtggctct cggcctagct       660
     ggggccccac agacccccgg cgtaggtcgc gcaatttggg taaggtcatc gataccctta       720
     cgtgcggctt cgccgacctc atggggtaca taccgctcgt cggcgcccct cttggaggcg       780
     ctgccagggc cctggcgcat ggcgtccggg ttctggaaga cggcgtgaac tatgcaacag       840
     ggaaccttcc tggttgctct ttctctatct tccttctggc cctgctctct tgcctgactg       900
     tgcccgcttc agcctaccaa gtgcgcaatt cctcggggct ttaccatgtc accaatgatt       960
     gccctaactc gagtattgtg tacgaggcgg ccgatgccat cctgcacact ccggggtgtg      1020
     tcccttgcgt tcgcgagggt aacgcctcga ggtgttgggt ggcggtgacc cccacggtgg      1080
     ccaccaggga cggcaaactc cccacaacgc agcttcgacg tcatatcgat ctgcttgtcg      1140
     ggagcgccac cctctgctcg gccctctacg tgggggacct gtgcgggtct gtctttcttg      1200
     ttggtcaact gtttaccttc tctcccaggc gccactggac gacgcaagac tgcaattgtt      1260
     ctatctatcc cggccatata acgggtcatc gcatggcatg ggatatgatg atgaactggt      1320
     cccctacggc agcgttggtg gtagctcagc tgctccggat cccacaagcc atcatggaca      1380
     tgatcgctgg tgctcactgg ggagtcctgg cgggcatagc gtatttctcc atggtgggga      1440
     actgggcgaa ggtcctggta gtgctgctgc tatttgccgg cgtcgacgcg gaaacccacg      1500
     tcaccggggg aagtgccggc cgcaccacgg ctgggcttgt tggtctcctt acaccaggcg      1560
     ccaagcagaa catccaactg atcaacacca acggcagttg gcacatcaat agcacggcct      1620
     tgaactgcaa tgaaagcctt aacaccggct ggttagcagg gctcttctat cagcacaaat      1680
     tcaactcttc aggctgtcct gagaggttgg ccagctgccg acgccttacc gattttgccc      1740
     agggctgggg tcctatcagt tatgccaacg gaagcggcct cgacgaacgc ccctactgct      1800
     ggcactaccc tccaagacct tgtggcattg tgcccgcaaa gagcgtgtgt ggcccggtat      1860
     attgcttcac tcccagcccc gtggtggtgg gaacgaccga caggtcgggc gcgcctacct      1920
     acagctgggg tgcaaatgat acggatgtct tcgtccttaa caacaccagg ccaccgctgg      1980
     gcaattggtt cggttgtacc tggatgaact caactggatt caccaaagtg tgcggagcgc      2040
     ccccttgtgt catcggaggg gtgggcaaca acaccttgct ctgccccact gattgtttcc      2100
     gcaagcatcc ggaagccaca tactctcggt gcggctccgg tccctggatt acacccaggt      2160
     gcatggtcga ctacccgtat aggctttggc actatccttg taccatcaat tacaccatat      2220
     tcaaagtcag gatgtacgtg ggaggggtcg agcacaggct ggaagcggcc tgcaactgga      2280
     cgcggggcga acgctgtgat ctggaagaca gggacaggtc cgagctcagc ccattgctgc      2340
     tgtccaccac acagtggcag gtccttccgt gttctttcac gaccctgcca gccttgtcca      2400
     ccggcctcat ccacctccac cagaacattg tggacgtgca gtacttgtac ggggtagggt      2460
     caagcatcgc gtcctgggcc attaagtggg agtacgtcgt tctcctgttc ctcctgcttg      2520
     cagacgcgcg cgtctgctcc tgcttgtgga tgatgttact catatcccaa gcggaggcgg      2580
     ctttggagaa cctcgtaata ctcaatgcag catccctggc cgggacgcac ggtcttgtgt      2640
     ccttcctcgt gttcttctgc tttgcgtggt atctgaaggg taggtgggtg cccggagcgg      2700
     tctacgcctt ctacgggatg tggcctctcc tcctgctcct gctggcgttg cctcagcggg      2760
     catacgcact ggacacggag gtggccgcgt cgtgtggcgg cgttgttctt gtcgggttaa      2820
     tggcgctgac tctgtcgcca tattacaagc gctacatcag ctggtgcatg tggtggcttc      2880
     agtattttct gaccagagta gaagcgcaac tgcacgtgtg ggttcccccc ctcaacgtcc      2940
     ggggggggcg cgatgccgtc atcttactca tgtgtgttgt acacccgact ctggtatttg      3000
     acatcaccaa actactcctg gccatcttcg gacccctttg gattcttcaa gccagtttgc      3060
     ttaaagtccc ctacttcgtg cgcgttcaag gccttctccg gatctgcgcg ctagcgcgga      3120
     agatagccgg aggtcattac gtgcaaatgg ccatcatcaa gttaggggcg cttactggca      3180
     cctatgtgta taaccatctc acccctcttc gagactgggc gcacaacggc ctgcgagatc      3240
     tggccgtggc tgtggaacca gtcgtcttct cccgaatgga gaccaagctc atcacgtggg      3300
     gggcagatac cgccgcgtgc ggtgacatca tcaacggctt gcccgtctct gcccgtaggg      3360
     gccaggagat actgcttggg ccagccgacg gaatggtctc caaggggtgg aggttgctgg      3420
     cgcccatcac ggcgtacgcc cagcagacga gaggcctcct agggtgtata atcaccagcc      3480
     tgactggccg ggacaaaaac caagtggagg gtgaggtcca gatcgtgtca actgctaccc      3540
     aaaccttcct ggcaacgtgc atcaatgggg tatgctggac tgtctaccac ggggccggaa      3600
     cgaggaccat cgcatcaccc aagggtcctg tcatccagat gtataccaat gtggaccaag      3660
     accttgtggg ctggcccgct cctcaaggtt cccgctcatt gacaccctgc acctgcggct      3720
     cctcggacct ttacctggtc acgaggcacg ccgatgtcat tcccgtgcgc cggcgaggtg      3780
     atagcagggg tagcctgctt tcgccccggc ccatttccta cttgaaaggc tcctcggggg      3840
     gtccgctgtt gtgccccgcg ggacacgccg tgggcctatt cagggccgcg gtgtgcaccc      3900
     gtggagtggc taaggcggtg gactttatcc ctgtggagaa cctagagaca accatgagat      3960
     ccccggtgtt cacggacaac tcctctccac cagcagtgcc ccagagcttc caggtggccc      4020
     acctgcatgc tcccaccggc agcggtaaga gcaccaaggt cccggctgcg tacgcagccc      4080
     agggctacaa ggtgttggtg ctcaacccct ctgttgctgc aacgctgggc tttggtgctt      4140
     acatgtccaa ggcccatggg gttgatccta atatcaggac cggggtgaga acaattacca      4200
     ctggcagccc catcacgtac tccacctacg gcaagttcct tgccgacggc gggtgctcag      4260
     gaggtgctta tgacataata atttgtgacg agtgccactc cacggatgcc acatccatct      4320
     tgggcatcgg cactgtcctt gaccaagcag agactgcggg ggcgagactg gttgtgctcg      4380
     ccactgctac ccctccgggc tccgtcactg tgtcccatcc taacatcgag gaggttgctc      4440
     tgtccaccac cggagagatc cctttttacg gcaaggctat ccccctcgag gtgatcaagg      4500
     ggggaagaca tctcatcttc tgccactcaa agaagaagtg cgacgagctc gccgcgaagc      4560
     tggtcgcatt gggcatcaat gccgtggcct actaccgcgg tcttgacgtg tctgtcatcc      4620
     cgaccagcgg cgatgttgtc gtcgtgtcga ccgatgctct catgactggc tttaccggcg      4680
     acttcgactc tgtgatagac tgcaacacgt gtgtcactca gacagtcgat ttcagccttg      4740
     accctacctt taccattgag acaaccacgc tcccccagga tgctgtctcc aggactcaac      4800
     gccggggcag gactggcagg gggaagccag gcatctacag atttgtggca ccgggggagc      4860
     gcccctccgg catgttcgac tcgtccgtcc tctgtgagtg ctatgacgcg ggctgtgctt      4920
     ggtatgagct cacgcccgcc gagactacag ttaggctacg agcgtacatg aacaccccgg      4980
     ggcttcccgt gtgccaggac catcttgaat tttgggaggg cgtctttacg ggcctcactc      5040
     atatagatgc ccactttcta tcccagacaa agcagagtgg ggagaacttt ccttacctgg      5100
     tagcgtacca agccaccgtg tgcgctaggg ctcaagcccc tcccccatcg tgggaccaga      5160
     tgtggaagtg tttgatccgc cttaaaccca ccctccatgg gccaacaccc ctgctataca      5220
     gactgggcgc tgttcagaat gaagtcaccc tgacgcaccc aatcaccaaa tacatcatga      5280
     catgcatgtc ggccgacctg gaggtcgtca cgagcacctg ggtgctcgtt ggcggcgtcc      5340
     tggctgctct ggccgcgtat tgcctgtcaa caggctgcgt ggtcatagtg ggcaggattg      5400
     tcttgtccgg gaagccggca attatacctg acagggaggt tctctaccag gagttcgatg      5460
     agatggaaga gtgctctcag cacttaccgt acatcgagca agggatgatg ctcgctgagc      5520
     agttcaagca gaaggccctc ggcctcctgc agaccgcgtc ccgccaagca gaggttatca      5580
     cccctgctgt ccagaccaac tggcagaaac tcgaggtctt ctgggcgaag cacatgtgga      5640
     atttcatcag tgggatacaa tacttggcgg gcctgtcaac gctgcctggt aaccccgcca      5700
     ttgcttcatt gatggctttt acagctgccg tcaccagccc actaaccact ggccaaaccc      5760
     tcctcttcaa catattgggg gggtgggtgg ctgcccagct cgccgccccc ggtgccgcta      5820
     ccgcctttgt gggcgctggc ttagctggcg ccgccatcgg cagcgttgga ctggggaagg      5880
     tcctcgtgga cattcttgca gggtatggcg cgggcgtggc gggagctctt gtagcattca      5940
     agatcatgag cggtgaggtc ccctccacgg aggacctggt caatctgctg cccgccatcc      6000
     tctcgcctgg agcccttgta gtcggtgtgg tctgcgcagc aatactgcgc cggcacgttg      6060
     gcccgggcga gggggcagtg caatggatga accggctaat agccttcgcc tcccggggga      6120
     accatgtttc ccccacgcac tacgtgccgg agagcgatgc agccgcccgc gtcactgcca      6180
     tactcagcag cctcactgta acccagctcc tgaggcgact gcatcagtgg ataagctcgg      6240
     agtgtaccac tccatgctcc ggttcctggc taagggacat ctgggactgg atatgcgagg      6300
     tgctgagcga ctttaagacc tggctgaaag ccaagctcat gccacaactg cctgggattc      6360
     cctttgtgtc ctgccagcgc gggtataggg gggtctggcg aggagacggc attatgcaca      6420
     ctcgctgcca ctgtggagct gagatcactg gacatgtcaa aaacgggacg atgaggatcg      6480
     tcggtcctag gacctgcagg aacatgtgga gtgggacgtt ccccattaac gcctacacca      6540
     cgggcccctg tactcccctt cctgcgccga actataagtt cgcgctgtgg agggtgtctg      6600
     cagaggaata cgtggagata aggcgggtgg gggacttcca ctacgtatcg ggtatgacta      6660
     ctgacaatct taaatgcccg tgccagatcc catcgcccga atttttcaca gaattggacg      6720
     gggtgcgcct acataggttt gcgccccctt gcaagccctt gctgcgggag gaggtatcat      6780
     tcagagtagg actccacgag tacccggtgg ggtcgcaatt accttgcgag cccgaaccgg      6840
     acgtagccgt gttgacgtcc atgctcactg atccctccca tataacagca gaggcggccg      6900
     ggagaaggtt ggcgagaggg tcaccccctt ctatggccag ctcctcggcc agccagctgt      6960
     ccgctccatc tctcaaggca acttgcaccg ccaaccatga ctcccctgac gccgagctca      7020
     tagaggctaa cctcctgtgg aggcaggaga tgggcggcaa catcaccagg gttgagtcag      7080
     agaacaaagt ggtgattctg gactccttcg atccgcttgt ggcagaggag gatgagcggg      7140
     aggtctccgt acccgcagaa attctgcgga agtctcggag attcgcccgg gccctgcccg      7200
     tttgggcgcg gccggactac aaccccccgc tagtagagac gtggaaaaag cctgactacg      7260
     aaccacctgt ggtccatggc tgcccgctac cacctccacg gtcccctcct gtgcctccgc      7320
     ctcggaaaaa gcgtacggtg gtcctcaccg aatcaaccct atctactgcc ttggccgagc      7380
     ttgccaccaa aagttttggc agctcctcaa cttccggcat tacgggcgac aatacgacaa      7440
     catcctctga gcccgcccct tctggctgcc cccccgactc cgacgttgag tcctattctt      7500
     ccatgccccc cctggagggg gagcctgggg atccggatct cagcgacggg tcatggtcga      7560
     cggtcagtag tggggccgac acggaagatg tcgtgtgctg ctcaatgtct tattcctgga      7620
     caggcgcact cgtcaccccg tgcgctgcgg aagaacaaaa actgcccatc aacgcactga      7680
     gcaactcgtt gctacgccat cacaatctgg tgtattccac cacttcacgc agtgcttgcc      7740
     aaaggcagaa gaaagtcaca tttgacagac tgcaagttct ggacagccat taccaggacg      7800
     tgctcaagga ggtcaaagca gcggcgtcaa aagtgaaggc taacttgcta tccgtagagg      7860
     aagcttgcag cctgacgccc ccacattcag ccaaatccaa gtttggctat ggggcaaaag      7920
     acgtccgttg ccatgccaga aaggccgtag cccacatcaa ctccgtgtgg aaagaccttc      7980
     tggaagacag tgtaacacca atagacacta ccatcatggc caagaacgag gttttctgcg      8040
     ttcagcctga gaaggggggt cgtaagccag ctcgtctcat cgtgttcccc gacctgggcg      8100
     tgcgcgtgtg cgagaagatg gccctgtacg acgtggttag caagctcccc ctggccgtga      8160
     tgggaagctc ctacggattc caatactcac caggacagcg ggttgaattc ctcgtgcaag      8220
     cgtggaagtc caagaagacc ccgatggggt tctcgtatga tacccgctgt tttgactcca      8280
     cagtcactga gagcgacatc cgtacggagg aggcaattta ccaatgttgt gacctggacc      8340
     cccaagcccg cgtggccatc aagtccctca ctgagaggct ttatgttggg ggccctctta      8400
     ccaattcaag gggggaaaac tgcggctacc gcaggtgccg cgcgagcggc gtactgacaa      8460
     ctagctgtgg taacaccctc acttgctaca tcaaggcccg ggcagcctgt cgagccgcag      8520
     ggctccagga ctgcaccatg ctcgtgtgtg gcgacgactt agtcgttatc tgtgaaagtg      8580
     cgggggtcca ggaggacgcg gcgagcctga gagccttcac ggaggctatg accaggtact      8640
     ccgccccccc cggggacccc ccacaaccag aatacgactt ggagcttata acatcatgct      8700
     cctccaacgt gtcagtcgcc cacgacggcg ctggaaagag ggtctactac cttacccgtg      8760
     accctacaac ccccctcgcg agagccgcgt gggagacagc aagacacact ccagtcaatt      8820
     cctggctagg caacataatc atgtttgccc ccacactgtg ggcgaggatg atactgatga      8880
     cccatttctt tagcgtcctc atagccaggg atcagcttga acaggctctt aactgtgaga      8940
     tctacggagc ctgctactcc atagaaccac tggatctacc tccaatcatt caaagactcc      9000
     atggcctcag cgcattttca ctccacagtt actctccagg tgaaatcaat agggtggccg      9060
     catgcctcag aaaacttggg gtcccgccct tgcgagcttg gagacaccgg gcccggagcg      9120
     tccgcgctag gcttctgtcc agaggaggca gggctgccat atgtggcaag tacctcttca      9180
     actgggcagt aagaacaaag ctcaaactca ctccaatagc ggccgctggc cggctggact      9240
     tgtccggttg gttcacggct ggctacagcg ggggagacat ttatcacagc gtgtctcatg      9300
     cccggccccg ctggttctgg ttttgcctac tcctgctcgc tgcaggggta ggcatctacc      9360
     tcctccccaa ccgatgaagg ttggggtaaa cactccggcc tcttaggcca tttcctgttt      9420
     tttttttttt tttttttttt tttttttttt tttttttttt ttttttttct tttttttttt      9480
     ttttttcctt tttttttttt ttttttttct ttccttcttt tttcctttct tttccttcct      9540
     tctttaatgg tggctccatc ttagccctag tcacggctag ctgtgaaagg tccgtgagcc      9600
     gcatgactgc agagagtgct gatactggcc tctctgcaga tcatgt                     9646
//

© 1998-2020 Legal notice