euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


Entry text : AF054247


[Entry details]
ID   AF054247; SV 1; linear; genomic RNA; STD; VRL; 9595 BP.
XX
AC   AF054247; 
XX
DT   06-MAY-1998 (Rel. 55, Created)
DT   23-JAN-2011 (Rel. 122, Last updated, Version 0)
XX
DE   Hepatitis C virus partial genome, complete 5'UTR, complete CDS (Contains:
DE   C, E1, E2, P7, NS2, NS3, NS4A, NS4B, NS5A, NS5B), partial 3'UTR.
XX
KW   partial genome; complete 5'UTR; complete CDS; C; E1; E2; P7; NS2; NS3;
KW   NS4A; NS4B; NS5A; NS5B; partial 3'UTR.
XX
OS   Hepatitis C virus subtype 1b
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae;
OC   Hepacivirus.
XX
RN   [1]
RP   1-9595
RX   DOI; 10.1006/viro.1998.9092.
RX   PUBMED; 9581788.
RA   Yanagi M., St Claire M., Shapiro M., Emerson S.U., Purcell R.H., Bukh J.;
RT   "Transcripts of a chimeric cDNA clone of hepatitis C virus genotype 1b are
RT   infectious in vivo";
RL   Virology 244(1):161-172(1998).
XX
RN   [2]
RP   1-9595
RA   Yanagi M., Bukh J.;
RT   ;
RL   Submitted (18-MAR-1998) to the EMBL/GenBank/DDBJ databases.
RL   Hepatitis Viruses Section, LID, NIAID, NIH, 7 Center Dr., Building 7, Room
RL   201, Bethesda, MD 20892, USA
XX
CC   This entry is part of the european Hepatitis C Virus database (euHCVdb,
CC   http://euhcvdb.ibcp.fr). The euHCVdb is funded as part of european
CC   contracts HepCVax (EC # QLK2-CT-2002-01329, http://hepcvax.ibcp.fr) and
CC   VIRGIL (EC # CT-2004-503359, http://www.virgil-net.org).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9595
FT                   /db_xref="taxon:31647"
FT                   /db_xref="EMBL:AF054247"
FT                   /db_xref="euHCVdb:D90208"
FT                   /genotype="1b"
FT                   /genotype_prov="1b"
FT                   /isolate="pCV-J4L6S"
FT                   /mol_type="genomic RNA"
FT                   /note="infectious full-length cDNA"
FT                   /organism="Hepatitis C virus subtype 1b"
FT                   /strain="HC-J4"
FT                   /genotype_conf="1b"
FT   5'UTR           1..341
FT                   /function="5'UTR highly conserved genomic region (contains
FT                   four structural domains (I to IV), domains II to IV make up
FT                   the internal ribosome entry site (IRES))"
FT                   /standard_name="5UTR"
FT   RBS             44..354
FT                   /function="The internal ribosome entry site (IRES) is made
FT                   up by domains II to IV of the 5'UTR"
FT                   /standard_name="IRES"
FT   stem_loop       1..20
FT                   /function="5'UTR domain I has a regulatory effect for the
FT                   replication and translation of the genome"
FT                   /standard_name="5UTR-dI"
FT   stem_loop       44..118
FT                   /function="5'UTR domain II is a component of the IRES"
FT                   /standard_name="5UTR-dII"
FT   stem_loop       125..323
FT                   /function="5'UTR domain III is a component of the IRES"
FT                   /standard_name="5UTR-dIII"
FT   stem_loop       331..354
FT                   /function="5'UTR domain IV is a component of the IRES"
FT                   /standard_name="5UTR-dIV"
FT   misc_feature    869..1292
FT                   /note="C/E1 genotyping region"
FT   misc_feature    8273..8612
FT                   /note="NS5B genotyping region"
FT   gene            342..9374
FT                   /locus_tag="HCVORF1"
FT   CDS             342..9374
FT                   /codon_start=1
FT                   /db_xref="UniProtKB/Swiss-Prot:O92972"
FT                   /locus_tag="HCVORF1"
FT                   /product="Complete HCV polyprotein (contains C, E1, E2, P7,
FT                   NS2, NS3, NS4A, NS4B, NS5A, NS5B)."
FT                   /translation="MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLG
FT                   VRATRKASERSQPRGRRQPIPKARRPEGRAWAQPGYPWPLYGNEGLGWAGWLLSPRGSR
FT                   PSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVN
FT                   YATGNLPGCSFSIFLLALLSCLTIPASAYEVRNVSGIYHVTNDCSNSSIVYEAADVIMH
FT                   TPGCVPCVQEGNSSRCWVALTPTLAARNASVPTTTIRRHVDLLVGTAAFCSAMYVGDLC
FT                   GSIFLVSQLFTFSPRRHETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTTALVVSQLLRI
FT                   PQAVVDMVAGAHWGVLAGLAYYSMVGNWAKVLIVALLFAGVDGETHTTGRVAGHTTSGF
FT                   TSLFSSGASQKIQLVNTNGSWHINRTALNCNDSLQTGFFAALFYAHKFNSSGCPERMAS
FT                   CRPIDWFAQGWGPITYTKPNSSDQRPYCWHYAPRPCGVVPASQVCGPVYCFTPSPVVVG
FT                   TTDRSGVPTYSWGENETDVMLLNNTRPPQGNWFGCTWMNSTGFTKTCGGPPCNIGGVGN
FT                   RTLICPTDCFRKHPEATYTKCGSGPWLTPRCLVDYPYRLWHYPCTLNFSIFKVRMYVGG
FT                   VEHRLNAACNWTRGERCNLEDRDRSELSPLLLSTTEWQILPCAFTTLPALSTGLIHLHQ
FT                   NIVDVQYLYGVGSAFVSFAIKWEYILLLFLLLADARVCACLWMMLLIAQAEAALENLVV
FT                   LNAASVAGAHGILSFLVFFCAAWYIKGRLAPGAAYAFYGVWPLLLLLLALPPRAYALDR
FT                   EMAASCGGAVLVGLVFLTLSPYYKVFLTRLIWWLQYFITRAEAHMQVWVPPLNVRGGRD
FT                   AIILLTCAVHPELIFDITKLLLAILGPLMVLQAGITRVPYFVRAQGLIRACMLVRKVAG
FT                   GHYVQMVFMKLGALTGTYVYNHLTPLRDWAHAGLRDLAVAVEPVVFSAMETKVITWGAD
FT                   TAACGDIILGLPVSARRGKEIFLGPADSLEGQGWRLLAPITAYSQQTRGVLGCIITSLT
FT                   GRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDLD
FT                   LVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSG
FT                   GPLLCPSGHVVGVFRAAVCTRGVAKAVDFIPVESMETTMRSPVFTDNSTPPAVPQTFQV
FT                   AHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRT
FT                   ITTGGSITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARL
FT                   VVLATATPPGSVTVPHPNIEEIGLSNNGEIPFYGKAIPIEAIKGGRHLIFCHSKKKCDE
FT                   LAAKLTGLGLNAVAYYRGLDVSVIPPIGDVVVVATDALMTGFTGDFDSVIDCNTCVTQT
FT                   VDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRSGIYRFVTPGERPSGMFDSSVLCEC
FT                   YDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQA
FT                   GDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVILT
FT                   HPITKYIMACMSADLEVVTSTWVLVGGVLAALAAYCLTTGSVVIVGRIILSGKPAVVPD
FT                   REVLYQEFDEMEECASQLPYIEQGMQLAEQFKQKALGLLQTATKQAEAAAPVVESKWRA
FT                   LETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTASITSPLTTQNTLLFNILGGW
FT                   VAAQLAPPSAASAFVGAGIAGAAVGSIGLGKVLVDILAGYGAGVAGALVAFKVMSGEVP
FT                   STEDLVNLLPAILSPGALVVGVVCAAILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTH
FT                   YVPESDAAARVTQILSSLTITQLLKRLHQWINEDCSTPCSGSWLRDVWDWICTVLTDFK
FT                   TWLQSKLLPRLPGVPFLSCQRGYKGVWRGDGIMQTTCPCGAQIAGHVKNGSMRIVGPRT
FT                   CSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNV
FT                   KCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREDVTFQVGLNQYLVGSQLPCEPEPDVT
FT                   VLTSMLTDPSHITAETAKRRLARGSPPSLASSSASQLSAPSLKATCTTHHDSPDADLIE
FT                   ANLLWRQEMGGNITRVESENKVVILDSFEPLHAEGDEREISVAAEILRKSRKFPSALPI
FT                   WARPDYNPPLLESWKDPDYVPPVVHGCPLPPTKAPPIPPPRRKRTVVLTESNVSSALAE
FT                   LATKTFGSSGSSAVDSGTATALPDLASDDGDKGSDVESYSSMPPLEGEPGDPDLSDGSW
FT                   STVSEEASEDVVCCSMSYTWTGALITPCAAEESKLPINPLSNSLLRHHNMVYATTSRSA
FT                   SLRQKKVTFDRLQVLDDHYRDVLKEMKAKASTVKAKLLSIEEACKLTPPHSAKSKFGYG
FT                   AKDVRNLSSRAVNHIRSVWEDLLEDTETPIDTTIMAKSEVFCVQPEKGGRKPARLIVFP
FT                   DLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPKQRVEFLVNTWKSKKCPMGFSYDTR
FT                   CFDSTVTESDIRVEESIYQCCDLAPEARQAIRSLTERLYIGGPLTNSKGQNCGYRRCRA
FT                   SGVLTTSCGNTLTCYLKATAACRAAKLQDCTMLVNGDDLVVICESAGTQEDAAALRAFT
FT                   EAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWET
FT                   ARHTPINSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLD
FT                   LPQIIERLHGLSAFTLHSYSPGEINRVASCLRKLGVPPLRTWRHRARSVRAKLLSQGGR
FT                   AATCGRYLFNWAVRTKLKLTPIPAASQLDLSGWFVAGYSGGDIYHSLSRARPRWFPLCL
FT                   LLLSVGVGIYLLPNR"
FT   mat_peptide     342..914
FT                   /function="C protein coding sequence (c sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="RNA binding nucleocapsid protein (p21) (capsid)
FT                   (core  protein) (nucleocapsid) (C protein). Produced by
FT                   proteolytic processing by the host signal peptidases"
FT                   /prod_ft=(pos:1..191, chain, "C protein")
FT                   /prod_ft=(pos:1..1, init_met, "Removed from C protein by
FT                   the cellular aminopeptidase")
FT                   /standard_name="C"
FT   mat_peptide     915..1490
FT                   /function="E1 protein coding sequence (e1 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="Envelope glycoprotein 1 (gp31) (E1 protein).
FT                   Produced by proteolytic processing by the host signal
FT                   peptidases. E1 forms heterodimers with the viral E2
FT                   envelope glycoprotein"
FT                   /prod_ft=(pos:192..383, chain, "E1 protein")
FT                   /prod_ft=(pos:353..381, transmem, "Potential transmembrane
FT                   region of E1")
FT                   /standard_name="E1"
FT   mat_peptide     1491..2579
FT                   /function="E2 protein coding sequence (e2 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="Envelope glycoprotein 2 (GP70) (E2 protein).
FT                   Produced by proteolytic processing by the host signal
FT                   peptidases. E2 forms heterodimers with the viral E1
FT                   envelope glycoprotein"
FT                   /prod_ft=(pos:384..746, chain, "E2 protein")
FT                   /prod_ft=(pos:384..410, site, "Hypervariable region 1
FT                   (HVR1)")
FT                   /prod_ft=(pos:473..480, site, "Hypervariable region 2
FT                   (HVR2)")
FT                   /prod_ft=(pos:659..670, domain, "PKR/eIF2aplha
FT                   phosporylation homology domain (PePHD)")
FT                   /prod_ft=(pos:718..741, transmem, "Potential transmembrane
FT                   region of E2")
FT                   /standard_name="E2"
FT   mat_peptide     2580..2768
FT                   /function="P7 protein coding sequence (p7 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="P7 protein. Produced by proteolytic processing by
FT                   the host signal peptidases"
FT                   /prod_ft=(pos:747..809, chain, "P7 protein")
FT                   /standard_name="P7"
FT   mat_peptide     2769..3419
FT                   /function="NS2 protein coding sequence (ns2 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS2 protein. Produced by autoproteolytic
FT                   processing"
FT                   /prod_ft=(pos:810..1026, chain, "Cysteine protease (NS2
FT                   protein) (P23)")
FT                   /prod_ft=(pos:903..1026, model3d, "NS2-3 autoprotease
FT                   catalytic domain domain (domain I) homology molecular model
FT                   using template PDB:2hd0")
FT                   /standard_name="NS2"
FT   mat_peptide     3420..5312
FT                   /function="NS3 protein coding sequence (ns3 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS3 protein. Produced by autoproteolytic
FT                   processing"
FT                   /prod_ft=(pos:1027..1657, chain, "NS3 protein (P70)
FT                   [Includes: N-ter serine protease; C-ter NTPase and RNA
FT                   helicase]")
FT                   /prod_ft=(pos:1027..1206, domain, "NS3 protease domain")
FT                   /prod_ft=(pos:1213..1657, domain, "NS3 helicase domain")
FT                   /prod_ft=(pos:1029..1657, model3d, "NS3 protein homology
FT                   molecular model using template PDB:1cu1A")
FT                   /standard_name="NS3"
FT   mat_peptide     5313..5474
FT                   /function="NS4A protein coding sequence (ns4a sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS4A protein. Produced by proteolytic processing
FT                   by the HCV NS3 protease"
FT                   /prod_ft=(pos:1658..1711, chain, "NS4A protein (P8)")
FT                   /prod_ft=(pos:1678..1689, domain, "NS3 protease cofactor")
FT                   /prod_ft=(pos:1678..1689, model3d, "NS4A homology molecular
FT                   model using template PDB:1cu1Z")
FT                   /standard_name="NS4A"
FT   mat_peptide     5475..6257
FT                   /function="NS4B protein coding sequence (ns4b sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS4B protein. Produced by proteolytic processing
FT                   by the HCV NS3 protease"
FT                   /prod_ft=(pos:1712..1972, chain, "NS4B protein (P27)")
FT                   /standard_name="NS4B"
FT   mat_peptide     6258..7598
FT                   /function="NS5A protein coding sequence (ns5a sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS5A protein. Produced by proteolytic processing
FT                   by the HCV NS3 protease. NS5A seems to have a
FT                   transcriptional activatory role"
FT                   /prod_ft=(pos:1973..2419, chain, "Serine phosphoprotein
FT                   (NS5A protein) (P58)")
FT                   /prod_ft=(pos:2209..2248, site, "Interferon sensitivity
FT                   determining region (ISDR)")
FT                   /prod_ft=(pos:2209..2274, domain, "PKR binding domain")
FT                   /prod_ft=(pos:2326..2334, site, "Nuclear localisation
FT                   signal (NLS)")
FT                   /prod_ft=(pos:2356..2379, site, "Variable region V3")
FT                   /prod_ft=(pos:2008..2170, model3d, "NS5A zinc-binding
FT                   domain (domain I) homology molecular model using template
FT                   PDB:1zh1")
FT                   /standard_name="NS5A"
FT   mat_peptide     7599..9371
FT                   /function="NS5B protein coding sequence (ns5b sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS5B protein. Produced by proteolytic processing
FT                   by the HCV NS3 protease. NS5B is a RNA-dependent RNA
FT                   polymerase that plays an essential role in virus
FT                   replication"
FT                   /prod_ft=(pos:2420..3010, chain, "RNA-dependent RNA
FT                   polymerase (NS5B protein) (P68)")
FT                   /prod_ft=(pos:2422..2985, model3d, "NS5B RNA-dependent RNA
FT                   polymerase homology molecular model using template PDB:
FT                   1c2pB")
FT                   /standard_name="NS5B"
FT   3'UTR           9375..9595
FT                   /function="3'UTR (contains a polypyrimidine stretch and the
FT                   conserved X region)"
FT                   /standard_name="3UTR"
XX
SQ   Sequence 9595 BP; 1934 A; 2842 C; 2698 G; 2121 T; 0 other;
     gccagccccc tgatgggggc gacactccac catgaatcac tcccctgtga ggaactactg        60
     tcttcacgca gaaagcgtct agccatggcg ttagtatgag tgtcgtgcag cctccaggac       120
     cccccctccc gggagagcca tagtggtctg cggaaccggt gagtacaccg gaattgccag       180
     gacgaccggg tcctttcttg gatcaacccg ctcaatgcct ggagatttgg gcgtgccccc       240
     gcgagactgc tagccgagta gtgttgggtc gcgaaaggcc ttgtggtact gcctgatagg       300
     gtgcttgcga gtgccccggg aggtctcgta gaccgtgcac catgagcacg aatcctaaac       360
     ctcaaagaaa aaccaaacgt aacaccaacc gccgcccaca ggacgtcaag ttcccgggcg       420
     gtggtcagat cgttggtgga gtttacctgt tgccgcgcag gggccccagg ttgggtgtgc       480
     gcgcgactag gaaggcttcc gagcggtcgc aacctcgtgg aaggcgacaa cctatcccaa       540
     aggctcgccg acccgagggc agggcctggg ctcagcccgg gtacccttgg cccctctatg       600
     gcaatgaggg cctggggtgg gcaggatggc tcctgtcacc ccgcggctcc cggcctagtt       660
     ggggccccac ggacccccgg cgtaggtcgc gtaacttggg taaggtcatc gataccctta       720
     catgcggctt cgccgatctc atggggtaca ttccgctcgt cggcgccccc ctagggggcg       780
     ctgccagggc cttggcacac ggtgtccggg ttctggagga cggcgtgaac tatgcaacag       840
     ggaacttgcc cggttgctct ttctctatct tcctcttggc tctgctgtcc tgtttgacca       900
     tcccagcttc cgcttatgaa gtgcgcaacg tgtccgggat ataccatgtc acgaacgact       960
     gctccaactc aagcattgtg tatgaggcag cggacgtgat catgcatact cccgggtgcg      1020
     tgccctgtgt tcaggagggt aacagctccc gttgctgggt agcgctcact cccacgctcg      1080
     cggccaggaa tgccagcgtc cccactacga caatacgacg ccacgtcgac ttgctcgttg      1140
     ggacggctgc tttctgctcc gctatgtacg tgggggatct ctgcggatct attttcctcg      1200
     tctcccagct gttcaccttc tcgcctcgcc ggcatgagac agtgcaggac tgcaactgct      1260
     caatctatcc cggccatgta tcaggtcacc gcatggcttg ggatatgatg atgaactggt      1320
     cacctacaac agccctagtg gtgtcgcagt tgctccggat cccacaagct gtcgtggaca      1380
     tggtggcggg ggcccactgg ggagtcctgg cgggccttgc ctactattcc atggtaggga      1440
     actgggctaa ggttctgatt gtggcgctac tctttgccgg cgttgacggg gagacccaca      1500
     cgacggggag ggtggccggc cacaccacct ccgggttcac gtcccttttc tcatctgggg      1560
     cgtctcagaa aatccagctt gtgaatacca acggcagctg gcacatcaac aggactgccc      1620
     taaattgcaa tgactccctc caaactgggt tctttgccgc gctgttttac gcacacaagt      1680
     tcaactcgtc cgggtgcccg gagcgcatgg ccagctgccg ccccattgac tggttcgccc      1740
     aggggtgggg ccccatcacc tatactaagc ctaacagctc ggatcagagg ccttattgct      1800
     ggcattacgc gcctcgaccg tgtggtgtcg tacccgcgtc gcaggtgtgt ggtccagtgt      1860
     attgtttcac cccaagccct gttgtggtgg ggaccaccga tcgttccggt gtccctacgt      1920
     atagctgggg ggagaatgag acagacgtga tgctcctcaa caacacgcgt ccgccacaag      1980
     gcaactggtt cggctgtaca tggatgaata gtactgggtt cactaagacg tgcggaggtc      2040
     ccccgtgtaa catcgggggg gtcggtaacc gcaccttgat ctgccccacg gactgcttcc      2100
     ggaagcaccc cgaggctact tacacaaaat gtggctcggg gccctggttg acacctaggt      2160
     gcctagtaga ctacccatac aggctttggc actacccctg cactctcaat ttttccatct      2220
     ttaaggttag gatgtatgtg gggggcgtgg agcacaggct caatgccgca tgcaattgga      2280
     ctcgaggaga gcgctgtaac ttggaggaca gggataggtc agaactcagc ccgctgctgc      2340
     tgtctacaac agagtggcag atactgccct gtgctttcac caccctaccg gctttatcca      2400
     ctggtttgat ccatctccat cagaacatcg tggacgtgca atacctgtac ggtgtagggt      2460
     cagcgtttgt ctcctttgca atcaaatggg agtacatcct gttgcttttc cttctcctgg      2520
     cagacgcgcg cgtgtgtgcc tgcttgtgga tgatgctgct gatagcccag gctgaggccg      2580
     ccttagagaa cttggtggtc ctcaatgcgg cgtccgtggc cggagcgcat ggtattctct      2640
     cctttcttgt gttcttctgc gccgcctggt acattaaggg caggctggct cctggggcgg      2700
     cgtatgcttt ttatggcgta tggccgctgc tcctgctcct actggcgtta ccaccacgag      2760
     cttacgcctt ggaccgggag atggctgcat cgtgcggggg tgcggttctt gtaggtctgg      2820
     tattcttgac cttgtcacca tactacaaag tgtttctcac taggctcata tggtggttac      2880
     aatactttat caccagagcc gaggcgcaca tgcaagtgtg ggtccccccc ctcaacgttc      2940
     ggggaggccg cgatgccatc atcctcctca cgtgtgcggt tcatccagag ttaatttttg      3000
     acatcaccaa actcctgctc gccatactcg gcccgctcat ggtgctccag gctggcataa      3060
     cgagagtgcc gtacttcgtg cgcgctcaag ggctcattcg tgcatgcatg ttagtgcgaa      3120
     aagtcgccgg gggtcattat gtccaaatgg tcttcatgaa gctgggcgcg ctgacaggta      3180
     cgtacgttta taaccatctt accccactgc gggactgggc ccacgcgggc ctacgagacc      3240
     ttgcggtggc ggtagagccc gtcgtcttct ccgccatgga gaccaaggtc atcacctggg      3300
     gagcagacac cgctgcgtgt ggggacatca tcttgggtct acccgtctcc gcccgaaggg      3360
     ggaaggagat atttttggga ccggctgata gtctcgaagg gcaagggtgg cgactccttg      3420
     cgcccatcac ggcctactcc caacaaacgc ggggcgtact tggttgcatc atcactagcc      3480
     tcacaggccg ggacaagaac caggtcgaag gggaggttca agtggtttct accgcaacac      3540
     aatctttcct ggcgacctgc atcaacggcg tgtgctggac tgtctaccat ggcgctggct      3600
     cgaagaccct agccggtcca aaaggtccaa tcacccaaat gtacaccaat gtagacctgg      3660
     acctcgtcgg ctggcaggcg ccccccgggg cgcgctccat gacaccatgc agctgtggca      3720
     gctcggacct ttacttggtc acgagacatg ctgatgtcat tccggtgcgc cggcgaggcg      3780
     acagcagggg aagtctactc tcccccaggc ccgtctccta cctgaaaggc tcctcgggtg      3840
     gtccattgct ttgcccttcg gggcacgtcg tgggcgtctt ccgggctgct gtgtgcaccc      3900
     ggggggtcgc gaaggcggtg gacttcatac ccgttgagtc tatggaaact accatgcggt      3960
     ctccggtctt cacagacaac tcaacccccc cggctgtacc gcagacattc caagtggcac      4020
     atctgcacgc tcctactggc agcggcaaga gcaccaaagt gccggctgcg tatgcagccc      4080
     aagggtacaa ggtgctcgtc ctgaacccgt ccgttgccgc caccttaggg tttggggcgt      4140
     atatgtccaa ggcacacggt atcgacccta acatcagaac tggggtaagg accattacca      4200
     cgggcggctc cattacgtac tccacctatg gcaagttcct tgccgacggt ggctgttctg      4260
     ggggcgccta tgacatcata atatgtgatg agtgccactc aactgactcg actaccatct      4320
     tgggcatcgg cacagtcctg gaccaagcgg agacggctgg agcgcggctc gtcgtgctcg      4380
     ccaccgctac acctccggga tcggttaccg tgccacaccc caatatcgag gaaataggcc      4440
     tgtccaacaa tggagagatc cccttctatg gcaaagccat ccccattgag gccatcaagg      4500
     gggggaggca tctcattttc tgccattcca agaagaaatg tgacgagctc gccgcaaagc      4560
     tgacaggcct cggactgaac gctgtagcat attaccgggg ccttgatgtg tccgtcatac      4620
     cgcctatcgg agacgtcgtt gtcgtggcaa cagacgctct aatgacgggt ttcaccggcg      4680
     attttgactc agtgatcgac tgcaatacat gtgtcaccca gacagtcgac ttcagcttgg      4740
     atcccacctt caccattgag acgacgaccg tgccccaaga cgcggtgtcg cgctcgcaac      4800
     ggcgaggtag aactggcagg ggtaggagtg gcatctacag gtttgtgact ccaggagaac      4860
     ggccctcggg catgttcgat tcttcggtcc tgtgtgagtg ctatgacgcg ggctgtgctt      4920
     ggtatgagct cacgcccgct gagacctcgg ttaggttgcg ggcttaccta aatacaccag      4980
     ggttgcccgt ctgccaggac catctggagt tctgggagag cgtcttcaca ggcctcaccc      5040
     acatagatgc ccacttcctg tcccagacta aacaggcagg agacaacttt ccttacctgg      5100
     tggcatatca agctacagtg tgcgccaggg ctcaagctcc acctccatcg tgggaccaaa      5160
     tgtggaagtg tctcatacgg ctgaaaccta cactgcacgg gccaacaccc ctgctgtata      5220
     ggctaggagc cgtccaaaat gaggtcatcc tcacacaccc cataactaaa tacatcatgg      5280
     catgcatgtc ggctgacctg gaggtcgtca ctagcacctg ggtgctggta ggcggagtcc      5340
     ttgcagcttt ggccgcatac tgcctgacga caggcagtgt ggtcattgtg ggcaggatca      5400
     tcttgtccgg gaagccagct gtcgttcccg acagggaagt cctctaccag gagttcgatg      5460
     agatggaaga gtgtgcctca caacttcctt acatcgagca gggaatgcag ctcgccgagc      5520
     aattcaagca aaaggcgctc gggttgttgc aaacggccac caagcaagcg gaggctgctg      5580
     ctcccgtggt ggagtccaag tggcgagccc ttgagacctt ctgggcgaag cacatgtgga      5640
     atttcatcag cggaatacag tacctagcag gcttatccac tctgcctgga aaccccgcga      5700
     tagcatcatt gatggcattt acagcttcta tcactagccc gctcaccacc caaaacaccc      5760
     tcctgtttaa catcttgggg ggatgggtgg ctgcccaact cgctcctccc agcgctgcgt      5820
     cagctttcgt gggcgccggc atcgccggag cggctgttgg cagcataggc cttgggaagg      5880
     tgctcgtgga catcttggcg ggctatgggg caggggtagc cggcgcactc gtggccttta      5940
     aggtcatgag cggcgaggtg ccctccaccg aggacctggt caacttactc cctgccatcc      6000
     tctctcctgg tgccctggtc gtcggggtcg tgtgcgcagc aatactgcgt cggcacgtgg      6060
     gcccgggaga gggggctgtg cagtggatga accggctgat agcgttcgct tcgcggggta      6120
     accacgtctc ccctacgcac tatgtgcctg agagcgacgc tgcagcacgt gtcactcaga      6180
     tcctctctag ccttaccatc actcaactgc tgaagcggct ccaccagtgg attaatgagg      6240
     actgctctac gccatgctcc ggctcgtggc taagggatgt ttgggattgg atatgcacgg      6300
     tgttgactga cttcaagacc tggctccagt ccaaactcct gccgcggtta ccgggagtcc      6360
     ctttcctgtc atgccaacgc gggtacaagg gagtctggcg gggggacggc atcatgcaaa      6420
     ccacctgccc atgcggagca cagatcgccg gacatgtcaa aaacggttcc atgaggatcg      6480
     tagggcctag aacctgcagc aacacgtggc acggaacgtt ccccatcaac gcatacacca      6540
     cgggaccttg cacaccctcc ccggcgccca actattccag ggcgctatgg cgggtggctg      6600
     ctgaggagta cgtggaggtt acgcgtgtgg gggatttcca ctacgtgacg ggcatgacca      6660
     ctgacaacgt aaagtgccca tgccaggttc cggcccccga attcttcacg gaggtggatg      6720
     gagtgcggtt gcacaggtac gctccggcgt gcaaacctct tctacgggag gacgtcacgt      6780
     tccaggtcgg gctcaaccaa tacttggtcg ggtcgcagct cccatgcgag cccgaaccgg      6840
     acgtaacagt gcttacttcc atgctcaccg atccctccca cattacagca gagacggcta      6900
     agcgtaggct ggctagaggg tctcccccct ctttagccag ctcatcagct agccagttgt      6960
     ctgcgccttc tttgaaggcg acatgcacta cccaccatga ctccccggac gctgacctca      7020
     tcgaggccaa cctcttgtgg cggcaggaga tgggcggaaa catcactcgc gtggagtcag      7080
     agaataaggt agtaattctg gactctttcg aaccgcttca cgcggagggg gatgagaggg      7140
     agatatccgt cgcggcggag atcctgcgaa aatccaggaa gttcccctca gcgttgccca      7200
     tatgggcacg cccggactac aatcctccac tgctagagtc ctggaaggac ccggactacg      7260
     tccctccggt ggtacacgga tgcccattgc cacctaccaa ggctcctcca ataccacctc      7320
     cacggagaaa gaggacggtt gtcctgacag aatccaatgt gtcttctgcc ttggcggagc      7380
     tcgccactaa gaccttcggt agctccggat cgtcggccgt tgatagcggc acggcgaccg      7440
     cccttcctga cctggcctcc gacgacggtg acaaaggatc cgacgttgag tcgtactcct      7500
     ccatgccccc ccttgaaggg gagccggggg accccgatct cagcgacggg tcttggtcta      7560
     ccgtgagtga ggaggctagt gaggatgtcg tctgctgctc aatgtcctat acgtggacag      7620
     gcgccctgat cacgccatgc gctgcggagg aaagtaagct gcccatcaac ccgttgagca      7680
     actctttgct gcgtcaccac aacatggtct acgccacaac atcccgcagc gcaagcctcc      7740
     ggcagaagaa ggtcaccttt gacagattgc aagtcctgga tgatcattac cgggacgtac      7800
     tcaaggagat gaaggcgaag gcgtccacag ttaaggctaa gcttctatct atagaggagg      7860
     cctgcaagct gacgccccca cattcggcca aatccaaatt tggctatggg gcaaaggacg      7920
     tccggaacct atccagcagg gccgttaacc acatccgctc cgtgtgggag gacttgctgg      7980
     aagacactga aacaccaatt gacaccacca tcatggcaaa aagtgaggtt ttctgcgtcc      8040
     aaccagagaa gggaggccgc aagccagctc gccttatcgt attcccagac ctgggagttc      8100
     gtgtatgcga gaagatggcc ctttacgacg tggtctccac ccttcctcag gccgtgatgg      8160
     gctcctcata cggatttcaa tactccccca agcagcgggt cgagttcctg gtgaatacct      8220
     ggaaatcaaa gaaatgccct atgggcttct catatgacac ccgctgtttt gactcaacgg      8280
     tcactgagag tgacattcgt gttgaggagt caatttacca atgttgtgac ttggcccccg      8340
     aggccagaca ggccataagg tcgctcacag agcggcttta catcgggggt cccctgacta      8400
     actcaaaagg gcagaactgc ggttatcgcc ggtgccgcgc aagtggcgtg ctgacgacta      8460
     gctgcggtaa taccctcaca tgttacttga aggccactgc agcctgtcga gctgcaaagc      8520
     tccaggactg cacgatgctc gtgaacggag acgaccttgt cgttatctgt gaaagcgcgg      8580
     gaacccagga ggatgcggcg gccctacgag ccttcacgga ggctatgact aggtattccg      8640
     ccccccccgg ggatccgccc caaccagaat acgacctgga gctgataaca tcatgttcct      8700
     ccaatgtgtc agtcgcgcac gatgcatctg gcaaaagggt atactacctc acccgtgacc      8760
     ccaccacccc ccttgcacgg gctgcgtggg agacagctag acacactcca atcaactctt      8820
     ggctaggcaa tatcatcatg tatgcgccca ccctatgggc aaggatgatt ctgatgactc      8880
     actttttctc catccttcta gctcaagagc aacttgaaaa agccctggat tgtcagatct      8940
     acggggcttg ctactccatt gagccacttg acctacctca gatcattgaa cgactccatg      9000
     gtcttagcgc atttacactc cacagttact ctccaggtga gatcaatagg gtggcttcat      9060
     gcctcaggaa acttggggta ccacccttgc gaacctggag acatcgggcc agaagtgtcc      9120
     gcgctaagct actgtcccag ggggggaggg ccgccacttg tggcagatac ctctttaact      9180
     gggcagtaag gaccaagctt aaactcactc caatcccggc cgcgtcccag ctggacttgt      9240
     ctggctggtt cgtcgctggt tacagcgggg gagacatata tcacagcctg tctcgtgccc      9300
     gaccccgctg gtttccgttg tgcctactcc tactttctgt aggggtaggc atttacctgc      9360
     tccccaaccg atgaacgggg agctaaccac tccaggcctt aagccatttc ctgttttttt      9420
     tttttttttt tttttttttt tctttttttt tttctttcct ttccttcttt ttttcctttc      9480
     tttttccctt ctttaatggt ggctccatct tagccctagt cacggctagc tgtgaaaggt      9540
     ccgtgagccg catgactgca gagagtgctg atactggcct ctctgcagat catgt           9595
//

© 1998-2020 Legal notice