euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


Entry text : L39309


[Entry details]
ID   L39309; SV 1; linear; genomic RNA; STD; VRL; 447 BP.
XX
AC   L39309; 
XX
DT   21-NOV-1995 (Rel. 45, Created)
DT   23-JAN-2011 (Rel. 122, Last updated, Version 0)
XX
DE   Hepatitis C virus partial genome, no 5'UTR, partial CDS (Contains: C, E1),
DE   no 3'UTR.
XX
KW   partial genome; partial CDS; C; E1.
XX
OS   Hepatitis C virus genotype 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae;
OC   Hepacivirus.
XX
RN   [1]
RP   1-447
RX   DOI; 10.1016/S0168-8278(94)80148-7.
RX   PUBMED; 7525693.
RA   van Doorn L.J., Kleter B., Stuyver L., Maertens G., Brouwer H., Schalm S.,
RA   Heijtink R., Quint W.;
RT   "Analysis of hepatitis C virus genotypes by a line probe assay and
RT   correlation with antibody profiles";
RL   J. Hepatol. 21(1):122-129(1994).
XX
RN   [2]
RP   1-447
RX   PUBMED; 9049395.
RA   van Doorn L.J., Kleter G.E., Stuyver L., Maertens G., Brouwer J.T., Schalm
RA   S.W., Heijtink R.A., Quint W.G.V.;
RT   "Sequence analysis of hepatitis C virus genotypes 1 to 5 reveals multiple
RT   novel subtypes in the Benelux countries";
RL   J. Gen. Virol. 76(Pt 7):1871-1876(1995).
XX
CC   This entry is part of the european Hepatitis C Virus database (euHCVdb,
CC   http://euhcvdb.ibcp.fr). The euHCVdb is funded as part of european
CC   contracts HepCVax (EC # QLK2-CT-2002-01329, http://hepcvax.ibcp.fr) and
CC   VIRGIL (EC # CT-2004-503359, http://www.virgil-net.org).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..447
FT                   /clone="NL50"
FT                   /db_xref="taxon:40271"
FT                   /db_xref="EMBL:L39309"
FT                   /db_xref="euHCVdb:D50409"
FT                   /genotype="2"
FT                   /genotype_conf="n.a."
FT                   /genotype_prov="2n"
FT                   /isolate="n.a."
FT                   /mol_type="genomic RNA"
FT                   /note="genotype: 2"
FT                   /organism="Hepatitis C virus genotype 2"
FT   misc_feature    51..>447
FT                   /note="C/E1 genotyping region"
FT   gene            <1..>447
FT                   /locus_tag="HCVORF1"
FT   CDS             <1..>447
FT                   /codon_start=1
FT                   /db_xref="UniProtKB/TrEMBL:Q81285"
FT                   /locus_tag="HCVORF1"
FT                   /product="Partial HCV polyprotein (contains C, E1)."
FT                   /translation="DGINYATGNLPGCSFSIFLLALLSCVTVPVSAVEVKNTSXXYMAT
FT                   NDCSNNSIVWQLEDAVLHVPGCVPCENSSGRFHCWIPISPNIAVSKPGALTKGLRAHID
FT                   AVVMSATLCSALYVGDVCGAVMIAAQAFIVAPKRHYFVQECNCSI"
FT   mat_peptide     <1..96
FT                   /function="C protein coding sequence (c sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="RNA binding nucleocapsid protein (p21) (capsid)
FT                   (core  protein) (nucleocapsid) (C protein). Produced by
FT                   proteolytic processing by the host signal peptidases"
FT                   /prod_ft=(pos:1..32, chain, "C protein")
FT                   /standard_name="C"
FT   mat_peptide     97..>447
FT                   /function="E1 protein coding sequence (e1 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="Envelope glycoprotein 1 (gp31) (E1 protein).
FT                   Produced by proteolytic processing by the host signal
FT                   peptidases. E1 forms heterodimers with the viral E2
FT                   envelope glycoprotein"
FT                   /prod_ft=(pos:33..149, chain, "E1 protein")
FT                   /standard_name="E1"
XX
SQ   Sequence 447 BP; 90 A; 125 C; 114 G; 116 T; 2 other;
     gacgggataa attatgcaac agggaacctt cctggttgct ccttttctat cttcttgttg        60
     gctcttctgt cttgtgtcac cgtgcctgtc tctgccgttg aggtcaaaaa taccagtcrg       120
     rcctatatgg caaccaacga ctgctccaac aacagcatcg tatggcaatt ggaggacgcg       180
     gtgcttcatg ttcctggatg tgtcccctgc gagaatagct ccggtcggtt ccactgttgg       240
     atcccgatct cgcccaacat agccgtgagc aaacctggtg ctctcaccaa gggactgcgg       300
     gcacacattg atgccgtcgt gatgtccgcc accctctgct ctgccctgta cgtgggagat       360
     gtgtgcggag cagtgatgat agctgcacag gctttcatcg tggcaccgaa gcgccattac       420
     ttcgtccagg aatgcaattg ctcaata                                           447
//

© 1998-2020 Legal notice