euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


Entry text : D37863


[Entry details]
ID   D37863; SV 1; linear; genomic RNA; STD; VRL; 1141 BP.
XX
AC   D37863; 
XX
DT   24-OCT-1995 (Rel. 45, Created)
DT   23-JAN-2011 (Rel. 122, Last updated, Version 0)
XX
DE   Hepatitis C virus partial genome, no 5'UTR, partial CDS (Contains: NS5B),
DE   partial 3'UTR.
XX
KW   partial genome; partial CDS; NS5B; partial 3'UTR.
XX
OS   Hepatitis C virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae;
OC   Hepacivirus.
XX
RN   [1]
RP   1-1141
RA   Okamoto H.;
RT   ;
RL   Submitted (02-AUG-1994) to the EMBL/GenBank/DDBJ databases.
RL   Hiroaki Okamoto, Jichi Medical School, Immunology Division;
RL   Minamikawachi-machi, Kawachi-gun, Tochigi 329-04, Japan (E-mail:
RL   hokamoto@jichi.ac.jp, Tel:0285-44-2111(ex.3334), Fax:0285-44-1557)
XX
RN   [2]
RP   1-1141
RX   PUBMED; 7561773.
RA   Tokita H., Okamoto H., Luengrojanakul P., Vareesangthip K., Chainuvati T.,
RA   Iizuka H., Tsuda F., Miyakawa Y., Mayumi M.;
RT   "Hepatitis C virus variants from Thailand classifiable into five novel
RT   genotypes in the sixth (6b), seventh (7c,7d) and ninth (9b, 9c) major
RT   genetic groups";
RL   J. Gen. Virol. 76:2329-2335(1995).
XX
CC   This entry is part of the european Hepatitis C Virus database (euHCVdb,
CC   http://euhcvdb.ibcp.fr). The euHCVdb is funded as part of european
CC   contracts HepCVax (EC # QLK2-CT-2002-01329, http://hepcvax.ibcp.fr) and
CC   VIRGIL (EC # CT-2004-503359, http://www.virgil-net.org).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1141
FT                   /db_xref="taxon:11103"
FT                   /db_xref="EMBL:D37863"
FT                   /db_xref="euHCVdb:DQ835762"
FT                   /genotype="n.a."
FT                   /genotype_conf="n.a."
FT                   /genotype_prov="6i"
FT                   /isolate="Th555"
FT                   /mol_type="genomic RNA"
FT                   /organism="Hepatitis C virus"
FT   misc_feature    <1..334
FT                   /note="NS5B genotyping region"
FT   gene            <1..1096
FT                   /locus_tag="HCVORF1"
FT   CDS             <1..1096
FT                   /codon_start=2
FT                   /db_xref="UniProtKB/TrEMBL:Q81606"
FT                   /locus_tag="HCVORF1"
FT                   /product="Partial HCV polyprotein (contains NS5B)."
FT                   /translation="VTERDIRAEQDIYLSCQLDPEAQQAIKSLTERLYVGGPMYNSKGQ
FT                   LCGQRRCRASGVLPTSMGNTITCFLKAKAACRAAGFTNFDMLVCGDDLVVIAESAGVNE
FT                   DIANLRAFTEAMTRYSATPGDPPSPSYDLELITSCSSNVSVAHDGDGRKYYYLTRDPVT
FT                   PLARAAWETARHTPVNSWLGNIIMYAPAIWVRMVLMTHFFQILQAQETLDKVLDFDIYG
FT                   VTHSITPLDLPVIIQRLHGMAAFSLHGYSPGELNRVAACLRKLGAPPLRAWRHRARAVR
FT                   AQLISRGGKAAICGKYLFNWAVKTKLKLTPLHGASNLDLSGWFAAGFSGGDVYHSASRA
FT                   RPRILLLCLLLLTVGVGIFLLPAR"
FT   mat_peptide     <1..1093
FT                   /function="NS5B protein coding sequence (ns5b sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="NS5B protein. Produced by proteolytic processing
FT                   by the HCV NS3 protease. NS5B is a RNA-dependent RNA
FT                   polymerase that plays an essential role in virus
FT                   replication"
FT                   /prod_ft=(pos:1..364, chain, "RNA-dependent RNA polymerase
FT                   (NS5B protein) (P68)")
FT                   /standard_name="NS5B"
FT   3'UTR           1097..>1141
FT                   /function="3'UTR (contains a polypyrimidine stretch and the
FT                   conserved X region)"
FT                   /standard_name="3UTR"
XX
SQ   Sequence 1141 BP; 261 A; 335 C; 292 G; 253 T; 0 other;
     ggtcacggag cgcgacatac gtgccgagca ggacatatat ctgtcttgcc agctggaccc        60
     agaagcccaa caggccatca agtctcttac cgagaggctt tacgttgggg gccctatgta       120
     caactcaaag ggccagctct gcggccagcg cagatgccgg gcgagcggag tgctgcccac       180
     gagcatgggc aacactataa catgctttct gaaagcgaaa gccgcttgcc gcgctgcagg       240
     cttcaccaac tttgacatgt tggtctgcgg agacgatttg gtggtcatcg ctgagagtgc       300
     tggggtcaac gaggatatcg ccaacctgcg agctttcacg gaagccatga ccaggtattc       360
     tgcgaccccc ggagatccac ccagcccgtc gtacgaccta gagctaataa catcatgctc       420
     ttcaaacgtt tccgtggccc atgatggaga cggcagaaaa tactactacc tcacccgaga       480
     cccagtcaca cctcttgcca gagcagcctg ggagactgcc cggcacactc cagttaactc       540
     gtggctgggg aacatcatca tgtacgctcc tgccatttgg gtccgtatgg tgctgatgac       600
     ccattttttc caaatactcc aagcacagga gacgttggac aaggtacttg acttcgatat       660
     atacggagtc actcactcaa tcactccact tgatctccca gtaatcatcc aaagactcca       720
     cggcatggcc gcattctcac tccatgggta ctctcctggc gaactcaatc gcgtggcagc       780
     atgcctcaga aagcttgggg ctcccccttt gagagcctgg agacaccgag cccgagcggt       840
     cagagcccag ctgatcagcc ggggggggaa agccgcaata tgcggcaagt acctcttcaa       900
     ttgggcggta aaaaccaagc tcaaactcac tccattgcat ggcgcgtcca acctggattt       960
     gtcaggttgg ttcgcggcag gcttcagcgg gggggacgtt tatcacagcg cgtccagggc      1020
     tcgaccccgc atattactcc tatgcctact cctactcaca gtaggggtag gcatcttttt      1080
     gctcccagct cgataggctg agagcttaac actccaaaca tctgtttttt tttttttttt      1140
     t                                                                      1141
//

© 1998-2020 Legal notice