euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


Entry text : D88474


[Entry details]
ID   D88474; SV 1; linear; genomic RNA; STD; VRL; 1583 BP.
XX
AC   D88474; 
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   23-JAN-2011 (Rel. 122, Last updated, Version 0)
XX
DE   Hepatitis C virus partial genome, complete 5'UTR, partial CDS (Contains: C,
DE   E1, E2), no 3'UTR.
XX
KW   partial genome; complete 5'UTR; partial CDS; C; E1; E2.
XX
OS   Hepatitis C virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae;
OC   Hepacivirus.
XX
RN   [1]
RP   1-1583
RA   Okamoto H.;
RT   ;
RL   Submitted (03-AUG-1996) to the EMBL/GenBank/DDBJ databases.
RL   Hiroaki Okamoto, Jichi Medical School, Immunology Division;
RL   Minamikawachi-machi, Kawachi-gun, Tochigi 329-04, Japan (E-mail:
RL   hokamoto@jichi.ac.jp, Tel:0285-44-2111(ex.3334), Fax:0285-44-1557)
XX
RN   [2]
RX   DOI; 10.1073/pnas.91.23.11022.
RX   PUBMED; 7972001.
RA   Tokita H., Okamoto H., Tsuda F., Song P., Nakata S., Chosa T., Iizuka H.,
RA   Mishiro S., Miyakawa Y., Mayumi M.;
RT   "Hepatitis C virus variants from Vietnam are classifiable into the seventh,
RT   eighth, and ninth major genetic groups";
RL   Proc. Natl. Acad. Sci. U.S.A. 91(23):11022-11026(1994).
XX
CC   This entry is part of the european Hepatitis C Virus database (euHCVdb,
CC   http://euhcvdb.ibcp.fr). The euHCVdb is funded as part of european
CC   contracts HepCVax (EC # QLK2-CT-2002-01329, http://hepcvax.ibcp.fr) and
CC   VIRGIL (EC # CT-2004-503359, http://www.virgil-net.org).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1583
FT                   /db_xref="taxon:11103"
FT                   /db_xref="EMBL:D88474"
FT                   /db_xref="euHCVdb:DQ314805"
FT                   /genotype="n.a."
FT                   /genotype_conf="n.a."
FT                   /genotype_prov="6e"
FT                   /isolate="VN540"
FT                   /mol_type="genomic RNA"
FT                   /organism="Hepatitis C virus"
FT   5'UTR           1..338
FT                   /function="5'UTR highly conserved genomic region (contains
FT                   four structural domains (I to IV), domains II to IV make up
FT                   the internal ribosome entry site (IRES))"
FT                   /standard_name="5UTR"
FT   RBS             41..351
FT                   /function="The internal ribosome entry site (IRES) is made
FT                   up by domains II to IV of the 5'UTR"
FT                   /standard_name="IRES"
FT   stem_loop       5..18
FT                   /function="5'UTR domain I has a regulatory effect for the
FT                   replication and translation of the genome"
FT                   /standard_name="5UTR-dI"
FT   stem_loop       41..115
FT                   /function="5'UTR domain II is a component of the IRES"
FT                   /standard_name="5UTR-dII"
FT   stem_loop       122..320
FT                   /function="5'UTR domain III is a component of the IRES"
FT                   /standard_name="5UTR-dIII"
FT   stem_loop       328..351
FT                   /function="5'UTR domain IV is a component of the IRES"
FT                   /standard_name="5UTR-dIV"
FT   misc_feature    866..1289
FT                   /note="C/E1 genotyping region"
FT   gene            339..>1583
FT                   /locus_tag="HCVORF1"
FT   CDS             339..>1583
FT                   /codon_start=1
FT                   /db_xref="UniProtKB/TrEMBL:P89961"
FT                   /locus_tag="HCVORF1"
FT                   /product="Partial HCV polyprotein (contains C, E1, E2)."
FT                   /translation="MSTLPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLG
FT                   VRATRKTSERSQPRGRRQPIPKVRHQTGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSR
FT                   PNWGPNDPRRRSRNLGKVIDTLTCGFADLMGYIPVVGAPLGGIAAALAHGVRAVEDGIN
FT                   YATGNLPGCSFSIFLLALLSCLTTPASAVHYTNKSGLYHLTNDCPNSSIVYEAPTIIMH
FT                   FPGCVPCVKVNNRSTCWLSASPTLAVPNASTPLTGFRKHVDLMVGAAAFCSAMYMGDIC
FT                   GGLFLLGQVVTIRPRLHQTVQECNCSIYTGKITGHRMAWDMMMNWSPTATLIVSYVMRV
FT                   PQLIIDILVGGHWGVLAGILYYSMVANWAKVIGILLLFAGVEAETYIIGAATGRTTAGL
FT                   TSLFSSGSQQNLQLVN"
FT   mat_peptide     339..911
FT                   /function="C protein coding sequence (c sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="RNA binding nucleocapsid protein (p21) (capsid)
FT                   (core  protein) (nucleocapsid) (C protein). Produced by
FT                   proteolytic processing by the host signal peptidases"
FT                   /prod_ft=(pos:1..191, chain, "C protein")
FT                   /prod_ft=(pos:1..1, init_met, "Removed from C protein by
FT                   the cellular aminopeptidase")
FT                   /standard_name="C"
FT   mat_peptide     912..1487
FT                   /function="E1 protein coding sequence (e1 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="Envelope glycoprotein 1 (gp31) (E1 protein).
FT                   Produced by proteolytic processing by the host signal
FT                   peptidases. E1 forms heterodimers with the viral E2
FT                   envelope glycoprotein"
FT                   /prod_ft=(pos:192..383, chain, "E1 protein")
FT                   /prod_ft=(pos:353..381, transmem, "Potential transmembrane
FT                   region of E1")
FT                   /standard_name="E1"
FT   mat_peptide     1488..>1583
FT                   /function="E2 protein coding sequence (e2 sequence)"
FT                   /locus_tag="HCVORF1"
FT                   /product="Envelope glycoprotein 2 (GP70) (E2 protein).
FT                   Produced by proteolytic processing by the host signal
FT                   peptidases. E2 forms heterodimers with the viral E1
FT                   envelope glycoprotein"
FT                   /prod_ft=(pos:384..415, chain, "E2 protein")
FT                   /prod_ft=(pos:384..410, site, "Hypervariable region 1
FT                   (HVR1)")
FT                   /standard_name="E2"
XX
SQ   Sequence 1583 BP; 305 A; 478 C; 445 G; 355 T; 0 other;
     gccagcccct aacggggcga cactccacca tgatcactcc cctgtgagga actactgtct        60
     tcacgcagaa agcgtctagc catggcgtta gtatgagtgt cgtgcagcct ccaggacccc       120
     ccctcccggg agagccatag tggtctgcgg aaccggtgag tacaccggaa ttgccaggac       180
     gaccgggtcc tttcttggat caacccgctc aatgcctgga gatttgggcg tgcccccgcg       240
     agactgctag ccgagtagtg ttgggtcgcg aaaggccttg tggtactgcc tgatagggtg       300
     cttgcgagtg ccccgggagg tctcgtagac cgtgcatcat gagcacactt cctaaacctc       360
     aaagaaaaac caaaagaaac accaaccgcc gcccacagga cgtcaagttc ccgggtggtg       420
     gtcagatcgt cggtggagtt tacttgttgc cgcgcagggg ccctcgtttg ggtgtgcgcg       480
     cgacgaggaa aacttctgaa cggtcccagc ctaggggtag acgccaacct ataccgaaag       540
     tgcgtcacca aacaggccgt acctgggctc agcccgggta cccctggcct ctttatggga       600
     atgagggctg cggctgggca gggtggctcc tgtccccccg cggctctcgc cctaattggg       660
     gccccaatga cccccggcgg agatcccgca acctgggtaa ggtcatcgat acccttactt       720
     gcggcttcgc cgacctcatg gggtacattc ccgttgttgg tgctcccctt gggggcatcg       780
     cggcagccct ggctcatggg gtcagggctg tggaggacgg gatcaactat gcaacaggga       840
     atcttcccgg ttgctctttc tctatcttcc ttttggcact gctctcgtgc ctcaccacgc       900
     ctgcctcagc cgtgcactat accaacaagt ctggtcttta ccacctgacc aatgactgcc       960
     ctaacagcag catcgtgtat gaggcgccaa ccattataat gcactttcct ggctgcgtcc      1020
     cctgtgtcaa ggtcaacaac cggtccacat gctggctgtc agcttcgccc acgctggctg      1080
     tcccgaacgc gtcaacacct ctcactgggt tccgcaaaca tgtggacctt atggtgggcg      1140
     cagctgcttt ctgttcagct atgtacatgg gtgacatatg tggtggtctg ttcctactcg      1200
     gacaggtcgt cacgattaga cctcgcctac accagaccgt ccaggagtgc aattgttcca      1260
     tctacacagg caagattact gggcatcgca tggcgtggga catgatgatg aattggtctc      1320
     cgaccgcgac tctcatcgtg tcctacgtca tgagggtgcc ccagttgatc attgacatac      1380
     ttgtgggcgg ccactggggc gtgttggctg ggatattata ctacagtatg gtggctaact      1440
     gggccaaggt catcggcatc cttctcctgt tcgcaggagt ggaggcggag acgtacatca      1500
     ttggcgccgc cactggccgg actaccgctg ggcttaccag ccttttctcc tcaggctccc      1560
     aacagaatct ccagcttgtg aac                                              1583
//

© 1998-2020 Legal notice