euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


View Sequence AF009606_903_1026_C1a


Tools

>gnl|euhcvdb|AF009606_903_1026_C1a NS2-3 autoprotease catalytic domain domain (domain I) homology molecular model using template PDB:2hd0
QASLLKVPYFVRVQGLLRICALARKIAGGHYVQMAIIKLGALTGTYVYNHLTPLRDWAHNGLRDLAVAVEPVVFSRMETK
LITWGADTAACGDIINGLPVSARRGQEILLGPADGMVSKGWRLL


© 1998-2020 Legal notice