euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


View Sequence AF009606_2209_2248_C1a


Tools

>gnl|euhcvdb|AF009606_2209_2248_C1a Interferon sensitivity determining region (ISDR)
PSLKATCTANHDSPDAELIEANLLWRQEMGGNITRVESEN


© 1998-2020 Legal notice