euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


View Sequence AF009606_2008_2170_C1a


Tools

>gnl|euhcvdb|AF009606_2008_2170_C1a NS5A zinc-binding domain (domain I) homology molecular model using template PDB:1zh1
FVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCRNMWSGTFPINAYTTGPCTPLPAPNYKFALWRVSA
EEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHEYPVGSQLPCEPEPD
VAV


© 1998-2020 Legal notice