euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


View Sequence L39309_P2n


Tools

>gnl|euhcvdb|L39309_P2n Partial HCV polyprotein (contains C, E1).
DGINYATGNLPGCSFSIFLLALLSCVTVPVSAVEVKNTSXXYMATNDCSNNSIVWQLEDAVLHVPGCVPCENSSGRFHCW
IPISPNIAVSKPGALTKGLRAHIDAVVMSATLCSALYVGDVCGAVMIAAQAFIVAPKRHYFVQECNCSI


© 1998-2020 Legal notice