euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


View Sequence L39309_E1_P2n


Tools

>gnl|euhcvdb|L39309_E1_P2n E1 protein
VEVKNTSXXYMATNDCSNNSIVWQLEDAVLHVPGCVPCENSSGRFHCWIPISPNIAVSKPGALTKGLRAHIDAVVMSATL
CSALYVGDVCGAVMIAAQAFIVAPKRHYFVQECNCSI


© 1998-2020 Legal notice