euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


View Sequence D37863_P6i


Tools

>gnl|euhcvdb|D37863_P6i Partial HCV polyprotein (contains NS5B).
VTERDIRAEQDIYLSCQLDPEAQQAIKSLTERLYVGGPMYNSKGQLCGQRRCRASGVLPTSMGNTITCFLKAKAACRAAG
FTNFDMLVCGDDLVVIAESAGVNEDIANLRAFTEAMTRYSATPGDPPSPSYDLELITSCSSNVSVAHDGDGRKYYYLTRD
PVTPLARAAWETARHTPVNSWLGNIIMYAPAIWVRMVLMTHFFQILQAQETLDKVLDFDIYGVTHSITPLDLPVIIQRLH
GMAAFSLHGYSPGELNRVAACLRKLGAPPLRAWRHRARAVRAQLISRGGKAAICGKYLFNWAVKTKLKLTPLHGASNLDL
SGWFAAGFSGGDVYHSASRARPRILLLCLLLLTVGVGIFLLPAR


© 1998-2020 Legal notice