euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


View Sequence AF054250_NS2_C1b


Tools

>gnl|euhcvdb|AF054250_NS2_C1b Cysteine protease (NS2 protein) (P23)
LDREMAASCGGAVLVGLVFLTLSPYYKVFLTRLIWWLQYFITRAEAHMQVWVPPLNVRGGRDAIILLTCAVHPELIFDIT
KLLLAILGPLMVLQAGITRVPYFVRAQGLIRACMLVRKVAGGHYVQMAFMKLGALTGTYVYNHLTPLRDWAHAGLRDLAV
AVEPVVFSXMETKVITWGADTAACGDIILGLPVSARRGKEIFLGPADSLEGQGWRLL


© 1998-2020 Legal notice