euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


View Sequence AF054250_1027_1206_C1b


Tools

>gnl|euhcvdb|AF054250_1027_1206_C1b NS3 protease domain
APITAYSQQTRGVLGCXITSLTGRDKNQVEGEVQVVSTATXSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDL
DLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFRAAVCT
RGVAKAVDFIPVESMETTMR


© 1998-2020 Legal notice