euHCVdb logo

The Nobel Prize in Physiology or Medicine 2020 "for the discovery of Hepatitis C virus".


View Sequence D88474_P6e


Tools

>gnl|euhcvdb|D88474_P6e Partial HCV polyprotein (contains C, E1, E2).
MSTLPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKVRHQTGRTWAQPG
YPWPLYGNEGCGWAGWLLSPRGSRPNWGPNDPRRRSRNLGKVIDTLTCGFADLMGYIPVVGAPLGGIAAALAHGVRAVED
GINYATGNLPGCSFSIFLLALLSCLTTPASAVHYTNKSGLYHLTNDCPNSSIVYEAPTIIMHFPGCVPCVKVNNRSTCWL
SASPTLAVPNASTPLTGFRKHVDLMVGAAAFCSAMYMGDICGGLFLLGQVVTIRPRLHQTVQECNCSIYTGKITGHRMAW
DMMMNWSPTATLIVSYVMRVPQLIIDILVGGHWGVLAGILYYSMVANWAKVIGILLLFAGVEAETYIIGAATGRTTAGLT
SLFSSGSQQNLQLVN


© 1998-2020 Legal notice